PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000823G0400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 296aa    MW: 32503.5 Da    PI: 5.4582
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000823G0400genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-092292622255
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  PH01000823G0400 229 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 262
                      59*****************************885 PP

2ELK28.53.5e-10182203122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK++Ll+KYsg+ + L++EF+
  PH01000823G0400 182 ELKEMLLKKYSGCFSRLRSEFL 203
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.1E-204286IPR005540KNOX1
PfamPF037901.3E-204483IPR005540KNOX1
SMARTSM012568.9E-2889140IPR005541KNOX2
PfamPF037912.4E-2493139IPR005541KNOX2
PROSITE profilePS512139.847182202IPR005539ELK domain
SMARTSM011882.7E-5182203IPR005539ELK domain
PfamPF037894.4E-8182203IPR005539ELK domain
PROSITE profilePS5007112.681202265IPR001356Homeobox domain
SuperFamilySSF466897.7E-20204273IPR009057Homeodomain-like
SMARTSM003892.5E-14204269IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-27207267IPR009057Homeodomain-like
CDDcd000862.95E-13214266No hitNo description
PfamPF059204.9E-17222261IPR008422Homeobox KN domain
PROSITE patternPS000270240263IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEDLYSIHPG ISRGGGAASE ASGVAGGARS PPPPPPPADL TELMKAQIAG HPRYPSLLSA  60
YIECRKVGAP PEVATLLEEI GRERCGRGGD GEIGLDPELD EFMEAYCRVL VRYKEELSRP  120
FDEAASFLSS IQTQLTSLCG GASTATSHSD EMVGSSEDEP CSGDADASDL GQEHSSRLAD  180
HELKEMLLKK YSGCFSRLRS EFLKKRKKGK LPKDARSALM DWWNTHYRWP YPTEEDKVRL  240
AAMTGLDPKQ INNWFINQRK RHWKPSEDMR FALMEGVTGG SSSGTTLYFD TGTIGP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197206LRSEFLKKRK
2203207KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0947170.0FP094717.1 Phyllostachys edulis cDNA clone: bphyst031k16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567581.11e-176PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-159KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLI1HEU41e-176I1HEU4_BRADI; Uncharacterized protein
STRINGBRADI2G11540.11e-175(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-78KNOTTED1-like homeobox gene 6